Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since over 3 years ago

Beginner

Summary

Created
October 20, 2022
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 15,211
  2. Avatar for baconsbi4u 2. baconsbi4u 4 pts. 13,800
  3. Avatar for GUGITBIOTECH 3. GUGITBIOTECH 1 pt. 11,405
  1. Avatar for Tiffanatisk Alvor 11. Tiffanatisk Alvor Lv 1 5 pts. 14,091
  2. Avatar for slashthedragon 12. slashthedragon Lv 1 4 pts. 13,991
  3. Avatar for Niklas 13. Niklas Lv 1 2 pts. 13,903
  4. Avatar for Isa wu 14. Isa wu Lv 1 2 pts. 13,896
  5. Avatar for JRemy747 15. JRemy747 Lv 1 1 pt. 13,855
  6. Avatar for Arendoth 16. Arendoth Lv 1 1 pt. 13,835
  7. Avatar for JoelleSBI4U 17. JoelleSBI4U Lv 1 1 pt. 13,800
  8. Avatar for bryand 18. bryand Lv 1 1 pt. 11,405
  9. Avatar for ntoro4 19. ntoro4 Lv 1 1 pt. 11,405
  10. Avatar for YogCtHuL 20. YogCtHuL Lv 1 1 pt. 11,405

Comments