Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since over 3 years ago

Beginner

Summary

Created
October 20, 2022
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 15,211
  2. Avatar for baconsbi4u 2. baconsbi4u 4 pts. 13,800
  3. Avatar for GUGITBIOTECH 3. GUGITBIOTECH 1 pt. 11,405
  1. Avatar for RichGuilmain
    1. RichGuilmain Lv 1
    100 pts. 15,386
  2. Avatar for Gonegirl 2. Gonegirl Lv 1 80 pts. 15,211
  3. Avatar for BrittanyBird 3. BrittanyBird Lv 1 63 pts. 15,091
  4. Avatar for sandy98 4. sandy98 Lv 1 49 pts. 14,712
  5. Avatar for Ju Young Oh 5. Ju Young Oh Lv 1 37 pts. 14,547
  6. Avatar for Dark Vamp 6. Dark Vamp Lv 1 28 pts. 14,431
  7. Avatar for stichlearner 7. stichlearner Lv 1 21 pts. 14,426
  8. Avatar for JordanXion 8. JordanXion Lv 1 15 pts. 14,163
  9. Avatar for angeluBSPS3B 9. angeluBSPS3B Lv 1 11 pts. 14,139
  10. Avatar for Takeraparterer 10. Takeraparterer Lv 1 8 pts. 14,137

Comments