Placeholder image of a protein
Icon representing a puzzle

2221: Electron Density Reconstruction 15

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
November 01, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
VESSTDGQVVPQEVLNLPLEKAHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 19,945
  2. Avatar for Australia 12. Australia 1 pt. 19,527
  3. Avatar for CureCoin 13. CureCoin 1 pt. 18,942
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 18,942
  5. Avatar for Gargleblasters 15. Gargleblasters 1 pt. 18,667
  6. Avatar for RubiscoBobGroup 16. RubiscoBobGroup 1 pt. 16,455
  7. Avatar for VCE Biology_NCB 17. VCE Biology_NCB 1 pt. 8,843

  1. Avatar for hada 41. hada Lv 1 4 pts. 20,119
  2. Avatar for MirsadaH 42. MirsadaH Lv 1 3 pts. 19,953
  3. Avatar for AlphaFold2 43. AlphaFold2 Lv 1 3 pts. 19,945
  4. Avatar for Alistair69 44. Alistair69 Lv 1 3 pts. 19,873
  5. Avatar for ProfVince 45. ProfVince Lv 1 2 pts. 19,821
  6. Avatar for Oransche 46. Oransche Lv 1 2 pts. 19,794
  7. Avatar for rezaefar 47. rezaefar Lv 1 2 pts. 19,792
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 2 pts. 19,742
  9. Avatar for ucad 49. ucad Lv 1 2 pts. 19,668
  10. Avatar for Crossed Sticks 50. Crossed Sticks Lv 1 1 pt. 19,649

Comments