Placeholder image of a protein
Icon representing a puzzle

2221: Electron Density Reconstruction 15

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 01, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
VESSTDGQVVPQEVLNLPLEKAHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 21,038
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 21,032
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 20,854
  4. Avatar for Contenders 4. Contenders 36 pts. 20,854
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 20,809
  6. Avatar for Hold My Beer 6. Hold My Beer 16 pts. 20,754
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 20,658
  8. Avatar for VeFold 8. VeFold 6 pts. 20,457
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 20,451
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 20,426
  1. Avatar for hada 41. hada Lv 1 4 pts. 20,119
  2. Avatar for MirsadaH 42. MirsadaH Lv 1 3 pts. 19,953
  3. Avatar for AlphaFold2 43. AlphaFold2 Lv 1 3 pts. 19,945
  4. Avatar for Alistair69 44. Alistair69 Lv 1 3 pts. 19,873
  5. Avatar for ProfVince 45. ProfVince Lv 1 2 pts. 19,821
  6. Avatar for Oransche 46. Oransche Lv 1 2 pts. 19,794
  7. Avatar for rezaefar 47. rezaefar Lv 1 2 pts. 19,792
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 2 pts. 19,742
  9. Avatar for ucad 49. ucad Lv 1 2 pts. 19,668
  10. Avatar for Crossed Sticks 50. Crossed Sticks Lv 1 1 pt. 19,649

Comments