Placeholder image of a protein
Icon representing a puzzle

2224: Electron Density Reconstruction 16

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 09, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 24,572
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 23,262
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 23,244
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 22,826
  5. Avatar for Gargleblasters 15. Gargleblasters 1 pt. 20,181
  1. Avatar for infjamc 31. infjamc Lv 1 9 pts. 25,989
  2. Avatar for kentish_alex 32. kentish_alex Lv 1 8 pts. 25,937
  3. Avatar for Vinara 33. Vinara Lv 1 8 pts. 25,872
  4. Avatar for equilibria 34. equilibria Lv 1 7 pts. 25,865
  5. Avatar for fiendish_ghoul 35. fiendish_ghoul Lv 1 6 pts. 25,666
  6. Avatar for Trajan464 36. Trajan464 Lv 1 6 pts. 25,548
  7. Avatar for CharaLilith 37. CharaLilith Lv 1 5 pts. 25,544
  8. Avatar for Komeiji_Koishi 38. Komeiji_Koishi Lv 1 5 pts. 25,509
  9. Avatar for fpc 39. fpc Lv 1 4 pts. 25,488
  10. Avatar for hada 40. hada Lv 1 4 pts. 25,459

Comments