Placeholder image of a protein
Icon representing a puzzle

2224: Electron Density Reconstruction 16

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 09, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 24,572
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 23,262
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 23,244
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 22,826
  5. Avatar for Gargleblasters 15. Gargleblasters 1 pt. 20,181
  1. Avatar for Gonegirl 41. Gonegirl Lv 1 3 pts. 25,375
  2. Avatar for rezaefar 42. rezaefar Lv 1 3 pts. 25,367
  3. Avatar for Merf 43. Merf Lv 1 3 pts. 25,339
  4. Avatar for NPrincipi 44. NPrincipi Lv 1 2 pts. 25,218
  5. Avatar for abiogenesis 45. abiogenesis Lv 1 2 pts. 25,145
  6. Avatar for ProfVince 46. ProfVince Lv 1 2 pts. 25,087
  7. Avatar for ucad 47. ucad Lv 1 2 pts. 25,043
  8. Avatar for Oransche 48. Oransche Lv 1 1 pt. 25,018
  9. Avatar for Alistair69 49. Alistair69 Lv 1 1 pt. 24,814
  10. Avatar for AlkiP0Ps 50. AlkiP0Ps Lv 1 1 pt. 24,750

Comments