Placeholder image of a protein
Icon representing a puzzle

2224: Electron Density Reconstruction 16

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
November 09, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 24,572
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 23,262
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 23,244
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 22,826
  5. Avatar for Gargleblasters 15. Gargleblasters 1 pt. 20,181

  1. Avatar for Silvercraft 71. Silvercraft Lv 1 1 pt. 23,010
  2. Avatar for kludbrook 72. kludbrook Lv 1 1 pt. 22,980
  3. Avatar for kaweave2 73. kaweave2 Lv 1 1 pt. 22,826
  4. Avatar for platinum9091 74. platinum9091 Lv 1 1 pt. 22,778
  5. Avatar for DipsyDoodle2016 75. DipsyDoodle2016 Lv 1 1 pt. 22,770
  6. Avatar for JRemy747 76. JRemy747 Lv 1 1 pt. 22,519
  7. Avatar for heyubob 77. heyubob Lv 1 1 pt. 20,181
  8. Avatar for spvincent 78. spvincent Lv 1 1 pt. 3,229
  9. Avatar for alaraints 79. alaraints Lv 1 1 pt. 3,229

Comments