Beginner Puzzle: Easy Mini Freestyle

Closed since about 3 years ago

Summary

• Created: November 17, 2022
• Expires: December 29, 2022 at 23:00 UTC
• Max points: 100

Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

• Sequence: STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

• 1. Go Science 100 pts. 8,371
• 2. L'Alliance Francophone 24 pts. 8,223
• 3. Rechenkraft.net 4 pts. 7,745
• 4. BBIO WARRIOR 1 pt. 7,610
• 5. Team China 1 pt. 3,872

Top evolvers

No scores of this type to display!