Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since about 3 years ago

Beginner

Summary

Created
November 17, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,371
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 24 pts. 8,223
  3. Avatar for Rechenkraft.net 3. Rechenkraft.net 4 pts. 7,745
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 7,610
  5. Avatar for Team China 5. Team China 1 pt. 3,872
  1. Avatar for NickMihal
    1. NickMihal Lv 1
    100 pts. 8,371
  2. Avatar for Arlz 2. Arlz Lv 1 96 pts. 8,371
  3. Avatar for lesther172 3. lesther172 Lv 1 92 pts. 8,223
  4. Avatar for BrittanyBird 4. BrittanyBird Lv 1 88 pts. 8,177
  5. Avatar for raincloud 5. raincloud Lv 1 84 pts. 8,138
  6. Avatar for chyna_soquena 6. chyna_soquena Lv 1 80 pts. 7,894
  7. Avatar for Dyeri_Geri 7. Dyeri_Geri Lv 1 77 pts. 7,843
  8. Avatar for TC2020232 8. TC2020232 Lv 1 73 pts. 7,826
  9. Avatar for CFirmalalala 9. CFirmalalala Lv 1 70 pts. 7,819
  10. Avatar for Bollo 10. Bollo Lv 1 67 pts. 7,790

Comments