Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since over 3 years ago

Beginner

Summary


Created
November 17, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups


  1. Avatar for Go Science 100 pts. 8,371
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 24 pts. 8,223
  3. Avatar for Rechenkraft.net 3. Rechenkraft.net 4 pts. 7,745
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 7,610
  5. Avatar for Team China 5. Team China 1 pt. 3,872

  1. Avatar for user939700 41. user939700 Lv 1 12 pts. 6,586
  2. Avatar for frances 42. frances Lv 1 11 pts. 6,585
  3. Avatar for Cyra_munoz 43. Cyra_munoz Lv 1 10 pts. 6,551
  4. Avatar for kyfrncsc 44. kyfrncsc Lv 1 10 pts. 6,534
  5. Avatar for krbgs 45. krbgs Lv 1 9 pts. 6,526
  6. Avatar for yunhuan 47. yunhuan Lv 1 8 pts. 6,516
  7. Avatar for HANA Y 48. HANA Y Lv 1 7 pts. 6,510
  8. Avatar for jeanrogue 49. jeanrogue Lv 1 7 pts. 6,500
  9. Avatar for vincentlaurence 50. vincentlaurence Lv 1 6 pts. 6,463

Comments