Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since over 3 years ago

Beginner

Summary


Created
November 17, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups


  1. Avatar for Go Science 100 pts. 8,371
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 24 pts. 8,223
  3. Avatar for Rechenkraft.net 3. Rechenkraft.net 4 pts. 7,745
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 7,610
  5. Avatar for Team China 5. Team China 1 pt. 3,872

  1. Avatar for Heysir 51. Heysir Lv 1 6 pts. 6,462
  2. Avatar for dionzonameegas 52. dionzonameegas Lv 1 5 pts. 6,456
  3. Avatar for frnclsh 53. frnclsh Lv 1 5 pts. 6,445
  4. Avatar for Ericka Orbigoso 54. Ericka Orbigoso Lv 1 5 pts. 6,445
  5. Avatar for katee 55. katee Lv 1 4 pts. 6,431
  6. Avatar for Alj_olivares 56. Alj_olivares Lv 1 4 pts. 6,429
  7. Avatar for Lyann Marie 57. Lyann Marie Lv 1 4 pts. 6,428
  8. Avatar for Deleted player 58. Deleted player pts. 6,427
  9. Avatar for JerryIson_ 60. JerryIson_ Lv 1 3 pts. 6,422

Comments