Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since over 3 years ago

Beginner

Summary


Created
November 17, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups


  1. Avatar for Go Science 100 pts. 8,371
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 24 pts. 8,223
  3. Avatar for Rechenkraft.net 3. Rechenkraft.net 4 pts. 7,745
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 7,610
  5. Avatar for Team China 5. Team China 1 pt. 3,872

  1. Avatar for Nicole Bobe 61. Nicole Bobe Lv 1 3 pts. 6,422
  2. Avatar for blurshie 62. blurshie Lv 1 3 pts. 6,419
  3. Avatar for Juleana Dymosco 63. Juleana Dymosco Lv 1 2 pts. 6,414
  4. Avatar for nanaaa 64. nanaaa Lv 1 2 pts. 6,411
  5. Avatar for kaye.lo 65. kaye.lo Lv 1 2 pts. 6,408
  6. Avatar for s2020369 67. s2020369 Lv 1 2 pts. 6,404
  7. Avatar for glomie 68. glomie Lv 1 2 pts. 6,398
  8. Avatar for 105 69. 105 Lv 1 2 pts. 6,396
  9. Avatar for rayray33 70. rayray33 Lv 1 1 pt. 6,396

Comments