Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since over 3 years ago

Beginner

Summary


Created
November 17, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups


  1. Avatar for Go Science 100 pts. 8,371
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 24 pts. 8,223
  3. Avatar for Rechenkraft.net 3. Rechenkraft.net 4 pts. 7,745
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 7,610
  5. Avatar for Team China 5. Team China 1 pt. 3,872

  1. Avatar for ritch 81. ritch Lv 1 1 pt. 6,254
  2. Avatar for eve 82. eve Lv 1 1 pt. 6,246
  3. Avatar for kopiko 83. kopiko Lv 1 1 pt. 6,243
  4. Avatar for princessmie_tuyor 84. princessmie_tuyor Lv 1 1 pt. 6,231
  5. Avatar for levels 85. levels Lv 1 1 pt. 6,226
  6. Avatar for Ju Young Oh 86. Ju Young Oh Lv 1 1 pt. 6,198
  7. Avatar for AndreaMaypa 87. AndreaMaypa Lv 1 1 pt. 6,195
  8. Avatar for tdesa 88. tdesa Lv 1 1 pt. 6,184
  9. Avatar for 1820656 89. 1820656 Lv 1 1 pt. 6,183
  10. Avatar for champss 90. champss Lv 1 1 pt. 6,171

Comments