Icon representing a puzzle

2230: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
November 22, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 7,700
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,435
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 6,080
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 0
  1. Avatar for g_b 21. g_b Lv 1 29 pts. 10,343
  2. Avatar for Phyx 22. Phyx Lv 1 27 pts. 10,295
  3. Avatar for maithra 23. maithra Lv 1 26 pts. 10,290
  4. Avatar for Sandrix72 24. Sandrix72 Lv 1 24 pts. 10,281
  5. Avatar for akaaka 25. akaaka Lv 1 22 pts. 10,217
  6. Avatar for WBarme1234 26. WBarme1234 Lv 1 21 pts. 10,166
  7. Avatar for drjr 27. drjr Lv 1 19 pts. 10,160
  8. Avatar for equilibria 28. equilibria Lv 1 18 pts. 10,151
  9. Avatar for Vinara 29. Vinara Lv 1 16 pts. 10,075
  10. Avatar for Pikkachurin 30. Pikkachurin Lv 1 15 pts. 10,062

Comments