Icon representing a puzzle

2230: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 22, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,779
  2. Avatar for Go Science 2. Go Science 68 pts. 10,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,437
  4. Avatar for Contenders 4. Contenders 27 pts. 10,400
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,349
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,166
  7. Avatar for Australia 7. Australia 5 pts. 9,816
  8. Avatar for AlphaFold 8. AlphaFold 3 pts. 9,543
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,062
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 8,490

  1. Avatar for g_b 21. g_b Lv 1 29 pts. 10,343
  2. Avatar for Phyx 22. Phyx Lv 1 27 pts. 10,295
  3. Avatar for maithra 23. maithra Lv 1 26 pts. 10,290
  4. Avatar for Sandrix72 24. Sandrix72 Lv 1 24 pts. 10,281
  5. Avatar for akaaka 25. akaaka Lv 1 22 pts. 10,217
  6. Avatar for WBarme1234 26. WBarme1234 Lv 1 21 pts. 10,166
  7. Avatar for drjr 27. drjr Lv 1 19 pts. 10,160
  8. Avatar for equilibria 28. equilibria Lv 1 18 pts. 10,151
  9. Avatar for Vinara 29. Vinara Lv 1 16 pts. 10,075
  10. Avatar for Pikkachurin 30. Pikkachurin Lv 1 15 pts. 10,062

Comments