Icon representing a puzzle

2230: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
November 22, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 7,700
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,435
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 6,080
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 0
  1. Avatar for hada 41. hada Lv 1 6 pts. 9,531
  2. Avatar for abiogenesis 42. abiogenesis Lv 1 6 pts. 9,405
  3. Avatar for ucad 43. ucad Lv 1 5 pts. 9,331
  4. Avatar for bamh 44. bamh Lv 1 5 pts. 9,267
  5. Avatar for Dr.Sillem 45. Dr.Sillem Lv 1 4 pts. 9,259
  6. Avatar for roarshock 46. roarshock Lv 1 4 pts. 9,230
  7. Avatar for Komeiji_Koishi 47. Komeiji_Koishi Lv 1 3 pts. 9,202
  8. Avatar for Merf 48. Merf Lv 1 3 pts. 9,176
  9. Avatar for Alistair69 49. Alistair69 Lv 1 3 pts. 9,123
  10. Avatar for jakeanderson 50. jakeanderson Lv 1 3 pts. 9,090

Comments