Icon representing a puzzle

2230: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
November 22, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,779
  2. Avatar for Go Science 2. Go Science 68 pts. 10,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,437
  4. Avatar for Contenders 4. Contenders 27 pts. 10,400
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,349
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,166
  7. Avatar for Australia 7. Australia 5 pts. 9,816
  8. Avatar for AlphaFold 8. AlphaFold 3 pts. 9,543
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,062
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 8,490
  1. Avatar for hada 41. hada Lv 1 6 pts. 9,531
  2. Avatar for abiogenesis 42. abiogenesis Lv 1 6 pts. 9,405
  3. Avatar for ucad 43. ucad Lv 1 5 pts. 9,331
  4. Avatar for bamh 44. bamh Lv 1 5 pts. 9,267
  5. Avatar for Dr.Sillem 45. Dr.Sillem Lv 1 4 pts. 9,259
  6. Avatar for roarshock 46. roarshock Lv 1 4 pts. 9,230
  7. Avatar for Komeiji_Koishi 47. Komeiji_Koishi Lv 1 3 pts. 9,202
  8. Avatar for Merf 48. Merf Lv 1 3 pts. 9,176
  9. Avatar for Alistair69 49. Alistair69 Lv 1 3 pts. 9,123
  10. Avatar for jakeanderson 50. jakeanderson Lv 1 3 pts. 9,090

Comments