Icon representing a puzzle

2230: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
November 22, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,779
  2. Avatar for Go Science 2. Go Science 68 pts. 10,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,437
  4. Avatar for Contenders 4. Contenders 27 pts. 10,400
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,349
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,166
  7. Avatar for Australia 7. Australia 5 pts. 9,816
  8. Avatar for AlphaFold 8. AlphaFold 3 pts. 9,543
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,062
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 8,490
  1. Avatar for robgee 81. robgee Lv 1 1 pt. 7,222
  2. Avatar for futsall 82. futsall Lv 1 1 pt. 6,999
  3. Avatar for furi0us 83. furi0us Lv 1 1 pt. 6,976
  4. Avatar for deathbat_87 84. deathbat_87 Lv 1 1 pt. 6,790
  5. Avatar for Sammy3c2b1a0 85. Sammy3c2b1a0 Lv 1 1 pt. 6,789
  6. Avatar for Sciren 86. Sciren Lv 1 1 pt. 6,080
  7. Avatar for JustinRothganger 87. JustinRothganger Lv 1 1 pt. 6,014
  8. Avatar for goober69 88. goober69 Lv 1 1 pt. 4,567
  9. Avatar for agcohn821 89. agcohn821 Lv 1 1 pt. 57
  10. Avatar for spvincent 90. spvincent Lv 1 1 pt. 0

Comments