Icon representing a puzzle

2233: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
December 01, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 8,601
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,628
  3. Avatar for Window Group 13. Window Group 1 pt. 0
  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 30 pts. 10,010
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 28 pts. 9,997
  3. Avatar for ProfVince 23. ProfVince Lv 1 26 pts. 9,992
  4. Avatar for zippyc137 24. zippyc137 Lv 1 25 pts. 9,917
  5. Avatar for guineapig 25. guineapig Lv 1 23 pts. 9,908
  6. Avatar for heather-1 26. heather-1 Lv 1 21 pts. 9,888
  7. Avatar for Vinara 27. Vinara Lv 1 20 pts. 9,877
  8. Avatar for alcor29 28. alcor29 Lv 1 19 pts. 9,857
  9. Avatar for Joanna_H 29. Joanna_H Lv 1 17 pts. 9,847
  10. Avatar for fpc 30. fpc Lv 1 16 pts. 9,839

Comments