Icon representing a puzzle

2233: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
December 01, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 8,601
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,628
  3. Avatar for Window Group 13. Window Group 1 pt. 0
  1. Avatar for Merf 41. Merf Lv 1 7 pts. 9,324
  2. Avatar for versat82 42. versat82 Lv 1 6 pts. 9,270
  3. Avatar for equilibria 43. equilibria Lv 1 5 pts. 9,167
  4. Avatar for prooh 44. prooh Lv 1 5 pts. 9,100
  5. Avatar for t.m.roach 45. t.m.roach Lv 1 5 pts. 9,074
  6. Avatar for kentish_alex 46. kentish_alex Lv 1 4 pts. 9,036
  7. Avatar for abiogenesis 47. abiogenesis Lv 1 4 pts. 9,018
  8. Avatar for rezaefar 48. rezaefar Lv 1 3 pts. 8,993
  9. Avatar for carxo 49. carxo Lv 1 3 pts. 8,966
  10. Avatar for Pibeagles1 50. Pibeagles1 Lv 1 3 pts. 8,938

Comments