Icon representing a puzzle

2233: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 01, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 8,601
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,628
  3. Avatar for Window Group 13. Window Group 1 pt. 0

  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 3 pts. 8,896
  2. Avatar for Trajan464 52. Trajan464 Lv 1 2 pts. 8,881
  3. Avatar for Th3-R4b8it 53. Th3-R4b8it Lv 1 2 pts. 8,818
  4. Avatar for bamh 54. bamh Lv 1 2 pts. 8,791
  5. Avatar for Gonegirl 55. Gonegirl Lv 1 2 pts. 8,715
  6. Avatar for ucad 56. ucad Lv 1 2 pts. 8,706
  7. Avatar for DScott 57. DScott Lv 1 1 pt. 8,697
  8. Avatar for Mohoernchen 58. Mohoernchen Lv 1 1 pt. 8,685
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 8,608
  10. Avatar for AlphaFold2 60. AlphaFold2 Lv 1 1 pt. 8,601

Comments