Icon representing a puzzle

2233: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
December 01, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 8,601
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,628
  3. Avatar for Window Group 13. Window Group 1 pt. 0

  1. Avatar for zbp 61. zbp Lv 1 1 pt. 8,600
  2. Avatar for Tiffanatisk Alvor 62. Tiffanatisk Alvor Lv 1 1 pt. 8,531
  3. Avatar for Wiz kid 63. Wiz kid Lv 1 1 pt. 8,508
  4. Avatar for manu8170 64. manu8170 Lv 1 1 pt. 8,496
  5. Avatar for Ju Young Oh 65. Ju Young Oh Lv 1 1 pt. 8,487
  6. Avatar for chaperoneKaty 66. chaperoneKaty Lv 1 1 pt. 8,429
  7. Avatar for vyndaquel 67. vyndaquel Lv 1 1 pt. 8,380
  8. Avatar for krbgs 68. krbgs Lv 1 1 pt. 8,360
  9. Avatar for lexiegeolingo 69. lexiegeolingo Lv 1 1 pt. 8,355
  10. Avatar for lconor 70. lconor Lv 1 1 pt. 8,342

Comments