Icon representing a puzzle

2233: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
December 01, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 8,601
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,628
  3. Avatar for Window Group 13. Window Group 1 pt. 0

  1. Avatar for jankristoffer 71. jankristoffer Lv 1 1 pt. 8,320
  2. Avatar for kminjin999 72. kminjin999 Lv 1 1 pt. 8,292
  3. Avatar for Briane Delo 73. Briane Delo Lv 1 1 pt. 8,271
  4. Avatar for 105 74. 105 Lv 1 1 pt. 8,166
  5. Avatar for Swapper242 75. Swapper242 Lv 1 1 pt. 8,116
  6. Avatar for futsall 76. futsall Lv 1 1 pt. 8,096
  7. Avatar for castlewoo 77. castlewoo Lv 1 1 pt. 8,090
  8. Avatar for qse3700 78. qse3700 Lv 1 1 pt. 7,986
  9. Avatar for Niklas 79. Niklas Lv 1 1 pt. 7,967
  10. Avatar for Larry17 80. Larry17 Lv 1 1 pt. 7,833

Comments