Icon representing a puzzle

2233: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
December 01, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,671
  2. Avatar for Go Science 2. Go Science 65 pts. 10,534
  3. Avatar for Contenders 3. Contenders 41 pts. 10,443
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 10,084
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,010
  6. Avatar for Australia 6. Australia 7 pts. 9,997
  7. Avatar for Gargleblasters 7. Gargleblasters 4 pts. 9,847
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 9,839
  9. Avatar for Hold My Beer 9. Hold My Beer 1 pt. 9,763
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 9,270
  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 57 pts. 10,305
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 54 pts. 10,276
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 51 pts. 10,274
  4. Avatar for akaaka 14. akaaka Lv 1 48 pts. 10,251
  5. Avatar for BackBuffer 15. BackBuffer Lv 1 45 pts. 10,241
  6. Avatar for g_b 16. g_b Lv 1 42 pts. 10,209
  7. Avatar for Idiotboy 17. Idiotboy Lv 1 39 pts. 10,193
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 37 pts. 10,084
  9. Avatar for blazegeek 19. blazegeek Lv 1 35 pts. 10,052
  10. Avatar for SemperRabbit 20. SemperRabbit Lv 1 32 pts. 10,013

Comments