Icon representing a puzzle

2233: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
December 01, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,671
  2. Avatar for Go Science 2. Go Science 65 pts. 10,534
  3. Avatar for Contenders 3. Contenders 41 pts. 10,443
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 10,084
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,010
  6. Avatar for Australia 6. Australia 7 pts. 9,997
  7. Avatar for Gargleblasters 7. Gargleblasters 4 pts. 9,847
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 9,839
  9. Avatar for Hold My Beer 9. Hold My Beer 1 pt. 9,763
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 9,270
  1. Avatar for jausmh 31. jausmh Lv 1 15 pts. 9,801
  2. Avatar for BarrySampson 32. BarrySampson Lv 1 14 pts. 9,784
  3. Avatar for Steven Pletsch 33. Steven Pletsch Lv 1 13 pts. 9,763
  4. Avatar for phi16 34. phi16 Lv 1 12 pts. 9,740
  5. Avatar for maithra 35. maithra Lv 1 11 pts. 9,632
  6. Avatar for hada 36. hada Lv 1 10 pts. 9,598
  7. Avatar for roarshock 37. roarshock Lv 1 9 pts. 9,590
  8. Avatar for NPrincipi 38. NPrincipi Lv 1 8 pts. 9,417
  9. Avatar for Alistair69 39. Alistair69 Lv 1 8 pts. 9,406
  10. Avatar for Oransche 40. Oransche Lv 1 7 pts. 9,330

Comments