Placeholder image of a protein
Icon representing a puzzle

2234: Electron Density Reconstruction 18

Closed since over 3 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary


Created
December 01, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GFEKYWFCYGIKCYYFDMDRKTWSGCKQTCQISSLSLLKIDNEDELKFLQNLAPSDISWIGFSYDNKKKDWAWIDNGPSKLALNTTKYNIRDGLCMSLSKTRLDNGDCGKSYICICGKRLDKFPH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 32,464
  2. Avatar for Go Science 2. Go Science 73 pts. 32,431
  3. Avatar for Contenders 3. Contenders 52 pts. 32,321
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 32,218
  5. Avatar for Hold My Beer 5. Hold My Beer 24 pts. 31,762
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 31,693
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 10 pts. 31,631
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 31,522
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 31,006
  10. Avatar for VeFold 10. VeFold 2 pts. 30,897

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 32,441
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 32,429
  3. Avatar for Galaxie 3. Galaxie Lv 1 89 pts. 32,341
  4. Avatar for MicElephant 4. MicElephant Lv 1 84 pts. 32,321
  5. Avatar for maithra 5. maithra Lv 1 79 pts. 32,317
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 75 pts. 32,274
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 70 pts. 32,253
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 66 pts. 32,244
  9. Avatar for gmn 9. gmn Lv 1 62 pts. 32,238
  10. Avatar for drjr 10. drjr Lv 1 58 pts. 32,230

Comments


horowsah Staff Lv 1

There's actually two identical copies next to each other in this one. So it's the same thing doubled.

LociOiling Lv 1

A little late, but I see AA Edit was unable to detect the two chains in this puzzle, instead showing just one chain with 248 segments. It appears the N terminals (segments 1 and 124) don't have the expected atom count.

The first chain is also missing the first two segments (G and F) stated in the puzzle description. The first chain is 123 segments, and the second chain is 125 segments. So the puzzle is not quite a dimer, since the two chains are not identical. This doesn't explain the issue with the atom counts.

Recipes can't really look at the protein, so looking at atom counts is the main way of detecting chains. That usually works, but some puzzles have non-standard atom counts. The other way for a recipe to detect chains is to look at the distance between the atom carbons of each pair of adjacent segments. This approach has its own set of problems on some puzzles that present a large protein with many segments trimmed away.

In this puzzle at least, the chain ID is shown in the segment information window. So segment 123 shows "PDB#: A 262", and segment 124 shows "PDB: B 138". So segment 123 is chain A, and segment 124 is chain B. Unfortunately, recipes can't access this information.

Anyway, here's my solution: