2234: Electron Density Reconstruction 18

Closed since over 3 years ago

Summary

• Created: December 01, 2022
• Expires: December 09, 2022 at 18:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

• Sequence: GFEKYWFCYGIKCYYFDMDRKTWSGCKQTCQISSLSLLKIDNEDELKFLQNLAPSDISWIGFSYDNKKKDWAWIDNGPSKLALNTTKYNIRDGLCMSLSKTRLDNGDCGKSYICICGKRLDKFPH

Top groups

• 1. Anthropic Dreams 100 pts. 32,464
• 2. Go Science 73 pts. 32,431
• 3. Contenders 52 pts. 32,321
• 4. Void Crushers 36 pts. 32,218
• 5. Hold My Beer 24 pts. 31,762
• 6. Marvin's bunch 16 pts. 31,693
• 7. FamilyBarmettler 10 pts. 31,631
• 8. L'Alliance Francophone 6 pts. 31,522
• 9. Gargleblasters 4 pts. 31,006
• 10. VeFold 2 pts. 30,897

Top soloists

• 1. LociOiling 100 pts. 32,441
• 2. Sandrix72 95 pts. 32,429
• 3. Galaxie 89 pts. 32,341
• 4. MicElephant 84 pts. 32,321
• 5. maithra 79 pts. 32,317
• 6. Bruno Kestemont 75 pts. 32,274
• 7. dcrwheeler 70 pts. 32,253
• 8. Punzi Baker 3 66 pts. 32,244
• 9. gmn 62 pts. 32,238
• 10. drjr 58 pts. 32,230

Comments

[Sandrix72]

The sequence of the protein should contain 248 letters, much more than those about 3.2 lines.

[horowsah]

There's actually two identical copies next to each other in this one. So it's the same thing doubled.

[LociOiling]

A little late, but I see AA Edit was unable to detect the two chains in this puzzle, instead showing just one chain with 248 segments. It appears the N terminals (segments 1 and 124) don't have the expected atom count.

The first chain is also missing the first two segments (G and F) stated in the puzzle description. The first chain is 123 segments, and the second chain is 125 segments. So the puzzle is not quite a dimer, since the two chains are not identical. This doesn't explain the issue with the atom counts.

Recipes can't really look at the protein, so looking at atom counts is the main way of detecting chains. That usually works, but some puzzles have non-standard atom counts. The other way for a recipe to detect chains is to look at the distance between the atom carbons of each pair of adjacent segments. This approach has its own set of problems on some puzzles that present a large protein with many segments trimmed away.

In this puzzle at least, the chain ID is shown in the segment information window. So segment 123 shows "PDB#: A 262", and segment 124 shows "PDB: B 138". So segment 123 is chain A, and segment 124 is chain B. Unfortunately, recipes can't access this information.

Anyway, here's my solution: