2237: Electron Density Reconstruction 19

Closed since about 3 years ago

Summary

• Created: December 08, 2022
• Expires: December 16, 2022 at 18:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle contains four copies of the protein.

• Sequence: MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS

Top groups

• 1. Anthropic Dreams 100 pts. 23,689
• 2. Contenders 73 pts. 23,578
• 3. Go Science 52 pts. 23,567
• 4. Hold My Beer 36 pts. 23,308
• 5. Void Crushers 24 pts. 23,240
• 6. Marvin's bunch 16 pts. 23,037
• 7. FamilyBarmettler 10 pts. 22,803
• 8. VeFold 4 pts. 22,629
• 9. AlphaFold 6 pts. 22,629
• 10. Gargleblasters 2 pts. 22,490

Top soloists

• 1. drjr 100 pts. 23,672
• 2. LociOiling 96 pts. 23,669
• 3. maithra 91 pts. 23,551
• 4. jeff101 86 pts. 23,535
• 5. gmn 82 pts. 23,523
• 6. grogar7 78 pts. 23,494
• 7. Bruno Kestemont 74 pts. 23,492
• 8. Sandrix72 70 pts. 23,469
• 9. Punzi Baker 3 66 pts. 23,421
• 10. MicElephant 63 pts. 23,369

Comments

[LociOiling]

Similar to ED Recon 18, recipes like AA Edit won't be able to detect the chains in this puzzle.

There are four chains with the sequence:

veqqfdlqkyrqqvrdisredledlfievvrqkmahenifkgmirqgs

All four chains are identical this time.

See PDB 3CS5 for the published solution.

[LociOiling]

I forgot to say it's a "tetramer", which is a type of aquarium fish.

[LociOiling]

The sequence shown in the puzzle description has MLPPLPDFSLS at the start, but these segments aren't present in the puzzle.

[LociOiling]

The missing MLPPLPDFSLS section is marked as "unmodeled" the sequence display for PDB 3CS5. The missing section is also listed in the PDB file, under the comment "the following residues were not located in the experiment".