Placeholder image of a protein
Icon representing a puzzle

2237: Electron Density Reconstruction 19

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
December 08, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle contains four copies of the protein.

Sequence
MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 22,401
  2. Avatar for L'Alliance Francophone 12. L'Alliance Francophone 1 pt. 22,091
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 22,060
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 21,712
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 21,507
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 18,616
  7. Avatar for CureCoin 17. CureCoin 1 pt. 14,771

  1. Avatar for Galaxie 11. Galaxie Lv 1 59 pts. 23,363
  2. Avatar for guineapig 12. guineapig Lv 1 56 pts. 23,321
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 53 pts. 23,321
  4. Avatar for Aubade01 14. Aubade01 Lv 1 50 pts. 23,318
  5. Avatar for Steven Pletsch 15. Steven Pletsch Lv 1 47 pts. 23,308
  6. Avatar for NPrincipi 16. NPrincipi Lv 1 44 pts. 23,261
  7. Avatar for spmm 17. spmm Lv 1 42 pts. 23,240
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 39 pts. 23,216
  9. Avatar for Idiotboy 19. Idiotboy Lv 1 37 pts. 23,189
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 35 pts. 23,113

Comments


LociOiling Lv 1

Similar to ED Recon 18, recipes like AA Edit won't be able to detect the chains in this puzzle.

There are four chains with the sequence:

veqqfdlqkyrqqvrdisredledlfievvrqkmahenifkgmirqgs

All four chains are identical this time.

See PDB 3CS5 for the published solution.

LociOiling Lv 1

The sequence shown in the puzzle description has MLPPLPDFSLS at the start, but these segments aren't present in the puzzle.

LociOiling Lv 1

The missing MLPPLPDFSLS section is marked as "unmodeled" the sequence display for PDB 3CS5. The missing section is also listed in the PDB file, under the comment "the following residues were not located in the experiment".