Placeholder image of a protein
Icon representing a puzzle

2237: Electron Density Reconstruction 19

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
December 08, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle contains four copies of the protein.

Sequence
MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 23,689
  2. Avatar for Contenders 2. Contenders 73 pts. 23,578
  3. Avatar for Go Science 3. Go Science 52 pts. 23,567
  4. Avatar for Hold My Beer 4. Hold My Beer 36 pts. 23,308
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 23,240
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 23,037
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 10 pts. 22,803
  8. Avatar for VeFold 8. VeFold 4 pts. 22,629
  9. Avatar for AlphaFold 9. AlphaFold 6 pts. 22,629
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 22,490

  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 3 pts. 21,578
  2. Avatar for carxo 52. carxo Lv 1 3 pts. 21,534
  3. Avatar for jankristoffer 53. jankristoffer Lv 1 3 pts. 21,525
  4. Avatar for georg137 54. georg137 Lv 1 3 pts. 21,504
  5. Avatar for abiogenesis 55. abiogenesis Lv 1 2 pts. 21,387
  6. Avatar for lexiegeolingo 56. lexiegeolingo Lv 1 2 pts. 21,259
  7. Avatar for Vinara 57. Vinara Lv 1 2 pts. 21,184
  8. Avatar for NickMihal 58. NickMihal Lv 1 2 pts. 21,152
  9. Avatar for Wiz kid 59. Wiz kid Lv 1 2 pts. 21,097
  10. Avatar for Oransche 60. Oransche Lv 1 2 pts. 21,014

Comments


LociOiling Lv 1

Similar to ED Recon 18, recipes like AA Edit won't be able to detect the chains in this puzzle.

There are four chains with the sequence:

veqqfdlqkyrqqvrdisredledlfievvrqkmahenifkgmirqgs

All four chains are identical this time.

See PDB 3CS5 for the published solution.

LociOiling Lv 1

The sequence shown in the puzzle description has MLPPLPDFSLS at the start, but these segments aren't present in the puzzle.

LociOiling Lv 1

The missing MLPPLPDFSLS section is marked as "unmodeled" the sequence display for PDB 3CS5. The missing section is also listed in the PDB file, under the comment "the following residues were not located in the experiment".