2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Summary

• Created: December 16, 2022
• Expires: December 23, 2022 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

• Sequence: DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

• 11. Team South Africa 1 pt. 9,032
• 12. Ogre's lab 1 pt. 8,868
• 13. Team China 1 pt. 8,842
• 14. BBIO WARRIOR 1 pt. 8,815
• 15. Foldit Staff 1 pt. 2,942

Top soloists

• 1. Sandrix72 100 pts. 10,159
• 2. LociOiling 97 pts. 10,128
• 3. NinjaGreg 93 pts. 10,122
• 4. Bruno Kestemont 89 pts. 10,122
• 5. grogar7 86 pts. 10,073
• 6. gmn 82 pts. 10,057
• 7. drjr 79 pts. 10,055
• 8. spmm 76 pts. 10,046
• 9. Bletchley Park 73 pts. 10,037
• 10. dcrwheeler 70 pts. 10,031

Comments

[LociOiling]

no TCR, just binder: https://foldit.fandom.com/wiki/Revisiting_puzzle/59:_TCR_Binding_Protein