Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638

  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 10,159
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 10,128
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 93 pts. 10,122
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 89 pts. 10,122
  5. Avatar for grogar7 5. grogar7 Lv 1 86 pts. 10,073
  6. Avatar for gmn 6. gmn Lv 1 82 pts. 10,057
  7. Avatar for drjr 7. drjr Lv 1 79 pts. 10,055
  8. Avatar for spmm 8. spmm Lv 1 76 pts. 10,046
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 73 pts. 10,037
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 70 pts. 10,031

Comments