Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638

  1. Avatar for Idiotboy 21. Idiotboy Lv 1 43 pts. 9,887
  2. Avatar for Aubade01 22. Aubade01 Lv 1 41 pts. 9,879
  3. Avatar for alcor29 23. alcor29 Lv 1 39 pts. 9,868
  4. Avatar for fiendish_ghoul 24. fiendish_ghoul Lv 1 38 pts. 9,841
  5. Avatar for guineapig 25. guineapig Lv 1 36 pts. 9,819
  6. Avatar for blazegeek 26. blazegeek Lv 1 34 pts. 9,809
  7. Avatar for BackBuffer 27. BackBuffer Lv 1 33 pts. 9,750
  8. Avatar for hada 28. hada Lv 1 31 pts. 9,725
  9. Avatar for akaaka 29. akaaka Lv 1 30 pts. 9,714
  10. Avatar for AlphaFold2 30. AlphaFold2 Lv 1 28 pts. 9,689

Comments