Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638

  1. Avatar for lezhe 71. lezhe Lv 1 2 pts. 8,842
  2. Avatar for Larini 72. Larini Lv 1 2 pts. 8,834
  3. Avatar for angeluBSPS3B 73. angeluBSPS3B Lv 1 2 pts. 8,815
  4. Avatar for fae 74. fae Lv 1 2 pts. 8,814
  5. Avatar for deemzoom 75. deemzoom Lv 1 2 pts. 8,806
  6. Avatar for EC2020431 76. EC2020431 Lv 1 2 pts. 8,796
  7. Avatar for nicolewong123 77. nicolewong123 Lv 1 2 pts. 8,787
  8. Avatar for Mohoernchen 78. Mohoernchen Lv 1 2 pts. 8,778
  9. Avatar for vyndaquel 79. vyndaquel Lv 1 1 pt. 8,717
  10. Avatar for CFirmalalala 80. CFirmalalala Lv 1 1 pt. 8,707

Comments