Placeholder image of a protein
Icon representing a puzzle

2241: Electron Density Reconstruction 20

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
December 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRRP

Top groups


  1. Avatar for L'Alliance Francophone 11. L'Alliance Francophone 1 pt. 20,909
  2. Avatar for Australia 12. Australia 1 pt. 20,830
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 20,829
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 19,867
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 19,745
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 19,639

  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 21,496
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 96 pts. 21,489
  3. Avatar for Aubade01 3. Aubade01 Lv 1 91 pts. 21,475
  4. Avatar for LociOiling 4. LociOiling Lv 1 87 pts. 21,467
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 83 pts. 21,448
  6. Avatar for drjr 6. drjr Lv 1 78 pts. 21,429
  7. Avatar for Galaxie 7. Galaxie Lv 1 75 pts. 21,407
  8. Avatar for MicElephant 8. MicElephant Lv 1 71 pts. 21,386
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 67 pts. 21,343
  10. Avatar for spmm 10. spmm Lv 1 64 pts. 21,335

Comments