Placeholder image of a protein
Icon representing a puzzle

2241: Electron Density Reconstruction 20

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
December 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRRP

Top groups


  1. Avatar for Go Science 100 pts. 21,498
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 21,467
  3. Avatar for Contenders 3. Contenders 49 pts. 21,386
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 21,335
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 21,240
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 21,236
  7. Avatar for Hold My Beer 7. Hold My Beer 8 pts. 21,198
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 21,187
  9. Avatar for AlphaFold 9. AlphaFold 3 pts. 20,972
  10. Avatar for VeFold 10. VeFold 2 pts. 20,972

  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 21,496
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 96 pts. 21,489
  3. Avatar for Aubade01 3. Aubade01 Lv 1 91 pts. 21,475
  4. Avatar for LociOiling 4. LociOiling Lv 1 87 pts. 21,467
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 83 pts. 21,448
  6. Avatar for drjr 6. drjr Lv 1 78 pts. 21,429
  7. Avatar for Galaxie 7. Galaxie Lv 1 75 pts. 21,407
  8. Avatar for MicElephant 8. MicElephant Lv 1 71 pts. 21,386
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 67 pts. 21,343
  10. Avatar for spmm 10. spmm Lv 1 64 pts. 21,335

Comments