Placeholder image of a protein
Icon representing a puzzle

2241: Electron Density Reconstruction 20

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
December 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRRP

Top groups


  1. Avatar for L'Alliance Francophone 11. L'Alliance Francophone 1 pt. 20,909
  2. Avatar for Australia 12. Australia 1 pt. 20,830
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 20,829
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 19,867
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 19,745
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 19,639

  1. Avatar for NinjaGreg
    1. NinjaGreg Lv 1
    100 pts. 21,498
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 63 pts. 21,492
  3. Avatar for Galaxie 3. Galaxie Lv 1 37 pts. 21,455
  4. Avatar for LociOiling 4. LociOiling Lv 1 21 pts. 21,447
  5. Avatar for alcor29 5. alcor29 Lv 1 11 pts. 21,399
  6. Avatar for MicElephant 6. MicElephant Lv 1 5 pts. 21,386
  7. Avatar for maithra 7. maithra Lv 1 2 pts. 21,298
  8. Avatar for equilibria 8. equilibria Lv 1 1 pt. 21,262
  9. Avatar for guineapig 9. guineapig Lv 1 1 pt. 21,241
  10. Avatar for fpc 10. fpc Lv 1 1 pt. 21,240

Comments