Placeholder image of a protein
Icon representing a puzzle

2241: Electron Density Reconstruction 20

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
December 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRRP

Top groups


  1. Avatar for Go Science 100 pts. 21,498
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 21,467
  3. Avatar for Contenders 3. Contenders 49 pts. 21,386
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 21,335
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 21,240
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 21,236
  7. Avatar for Hold My Beer 7. Hold My Beer 8 pts. 21,198
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 21,187
  9. Avatar for AlphaFold 9. AlphaFold 3 pts. 20,972
  10. Avatar for VeFold 10. VeFold 2 pts. 20,972

  1. Avatar for Oransche 11. Oransche Lv 1 1 pt. 21,231
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 1 pt. 21,208

Comments