Icon representing a puzzle

2243: Revisiting Puzzle 60: Beta Barrel

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
December 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 11,274
  2. Avatar for Australia 12. Australia 1 pt. 11,268
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 11,246
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 11,131

  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 23 pts. 12,031
  2. Avatar for AlphaFold2 22. AlphaFold2 Lv 1 21 pts. 12,030
  3. Avatar for NPrincipi 23. NPrincipi Lv 1 19 pts. 11,999
  4. Avatar for MicElephant 24. MicElephant Lv 1 17 pts. 11,996
  5. Avatar for ProfVince 25. ProfVince Lv 1 16 pts. 11,993
  6. Avatar for drjr 26. drjr Lv 1 15 pts. 11,989
  7. Avatar for hada 27. hada Lv 1 13 pts. 11,973
  8. Avatar for BarrySampson 28. BarrySampson Lv 1 12 pts. 11,942
  9. Avatar for stomjoh 29. stomjoh Lv 1 11 pts. 11,939
  10. Avatar for equilibria 30. equilibria Lv 1 10 pts. 11,922

Comments