Placeholder image of a protein
Icon representing a puzzle

2250: Electron Density Reconstruction 23

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
January 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Of note, you may have seen this protein in puzzles before, but the structure is solved a bit differently here.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSALDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 27,147
  2. Avatar for Australia 12. Australia 1 pt. 27,076
  1. Avatar for spmm 11. spmm Lv 1 48 pts. 27,346
  2. Avatar for drjr 12. drjr Lv 1 44 pts. 27,336
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 41 pts. 27,321
  4. Avatar for guineapig 14. guineapig Lv 1 37 pts. 27,320
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 34 pts. 27,319
  6. Avatar for Bletchley Park 16. Bletchley Park Lv 1 32 pts. 27,311
  7. Avatar for ucad 17. ucad Lv 1 29 pts. 27,311
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 27 pts. 27,295
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 24 pts. 27,294
  10. Avatar for maithra 20. maithra Lv 1 22 pts. 27,289

Comments