Placeholder image of a protein
Icon representing a puzzle

2250: Electron Density Reconstruction 23

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
January 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Of note, you may have seen this protein in puzzles before, but the structure is solved a bit differently here.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSALDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 27,147
  2. Avatar for Australia 12. Australia 1 pt. 27,076
  1. Avatar for akaaka 21. akaaka Lv 1 20 pts. 27,282
  2. Avatar for Idiotboy 22. Idiotboy Lv 1 18 pts. 27,254
  3. Avatar for Steven Pletsch 23. Steven Pletsch Lv 1 17 pts. 27,250
  4. Avatar for roarshock 24. roarshock Lv 1 15 pts. 27,249
  5. Avatar for NPrincipi 25. NPrincipi Lv 1 14 pts. 27,241
  6. Avatar for Silvercraft 26. Silvercraft Lv 1 12 pts. 27,220
  7. Avatar for alcor29 27. alcor29 Lv 1 11 pts. 27,215
  8. Avatar for Joanna_H 28. Joanna_H Lv 1 10 pts. 27,202
  9. Avatar for bamh 29. bamh Lv 1 9 pts. 27,190
  10. Avatar for ShadowTactics 30. ShadowTactics Lv 1 8 pts. 27,189

Comments