Placeholder image of a protein
Icon representing a puzzle

2250: Electron Density Reconstruction 23

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
January 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Of note, you may have seen this protein in puzzles before, but the structure is solved a bit differently here.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSALDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 27,147
  2. Avatar for Australia 12. Australia 1 pt. 27,076
  1. Avatar for jausmh 31. jausmh Lv 1 7 pts. 27,188
  2. Avatar for phi16 32. phi16 Lv 1 6 pts. 27,186
  3. Avatar for stomjoh 33. stomjoh Lv 1 6 pts. 27,185
  4. Avatar for equilibria 34. equilibria Lv 1 5 pts. 27,172
  5. Avatar for rezaefar 35. rezaefar Lv 1 5 pts. 27,165
  6. Avatar for crpainter 36. crpainter Lv 1 4 pts. 27,153
  7. Avatar for AlphaFold2 37. AlphaFold2 Lv 1 4 pts. 27,147
  8. Avatar for Trajan464 38. Trajan464 Lv 1 3 pts. 27,125
  9. Avatar for BarrySampson 39. BarrySampson Lv 1 3 pts. 27,121
  10. Avatar for sitlux 40. sitlux Lv 1 3 pts. 27,104

Comments