Placeholder image of a protein
Icon representing a puzzle

2250: Electron Density Reconstruction 23

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
January 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Of note, you may have seen this protein in puzzles before, but the structure is solved a bit differently here.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSALDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 27,147
  2. Avatar for Australia 12. Australia 1 pt. 27,076

  1. Avatar for RichGuilmain 51. RichGuilmain Lv 1 1 pt. 26,760
  2. Avatar for fpc 52. fpc Lv 1 1 pt. 26,686
  3. Avatar for frostschutz 53. frostschutz Lv 1 1 pt. 26,610
  4. Avatar for carxo 54. carxo Lv 1 1 pt. 26,588
  5. Avatar for spvincent 55. spvincent Lv 1 1 pt. 26,583
  6. Avatar for Merf 56. Merf Lv 1 1 pt. 26,570
  7. Avatar for Dr.Sillem 57. Dr.Sillem Lv 1 1 pt. 26,566
  8. Avatar for zbp 58. zbp Lv 1 1 pt. 26,541
  9. Avatar for RWoodcock 59. RWoodcock Lv 1 1 pt. 26,535
  10. Avatar for Mohoernchen 60. Mohoernchen Lv 1 1 pt. 26,509

Comments