Placeholder image of a protein
Icon representing a puzzle

2250: Electron Density Reconstruction 23

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
January 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Of note, you may have seen this protein in puzzles before, but the structure is solved a bit differently here.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSALDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 27,147
  2. Avatar for Australia 12. Australia 1 pt. 27,076
  1. Avatar for mart0258 61. mart0258 Lv 1 1 pt. 26,503
  2. Avatar for vyndaquel 62. vyndaquel Lv 1 1 pt. 26,493
  3. Avatar for rinze 63. rinze Lv 1 1 pt. 26,482
  4. Avatar for itsnyxtho 64. itsnyxtho Lv 1 1 pt. 26,468
  5. Avatar for robgee 65. robgee Lv 1 1 pt. 26,422
  6. Avatar for walenz 66. walenz Lv 1 1 pt. 26,422
  7. Avatar for Wenny_007 67. Wenny_007 Lv 1 1 pt. 26,420
  8. Avatar for Swapper242 68. Swapper242 Lv 1 1 pt. 26,406
  9. Avatar for harvardman 69. harvardman Lv 1 1 pt. 25,965
  10. Avatar for DScott 70. DScott Lv 1 1 pt. 25,562

Comments