Icon representing a puzzle

2252: Revisiting Puzzle 63: Spinach Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
January 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 10,588
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,437

  1. Avatar for blazegeek 21. blazegeek Lv 1 24 pts. 10,908
  2. Avatar for Steven Pletsch 22. Steven Pletsch Lv 1 22 pts. 10,908
  3. Avatar for BootsMcGraw 23. BootsMcGraw Lv 1 20 pts. 10,895
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 18 pts. 10,868
  5. Avatar for MicElephant 25. MicElephant Lv 1 17 pts. 10,862
  6. Avatar for guineapig 26. guineapig Lv 1 15 pts. 10,831
  7. Avatar for NPrincipi 27. NPrincipi Lv 1 14 pts. 10,817
  8. Avatar for ProfVince 28. ProfVince Lv 1 13 pts. 10,810
  9. Avatar for jausmh 29. jausmh Lv 1 12 pts. 10,763
  10. Avatar for AlkiP0Ps 30. AlkiP0Ps Lv 1 11 pts. 10,760

Comments