Icon representing a puzzle

2252: Revisiting Puzzle 63: Spinach Protein

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Go Science 100 pts. 11,337
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,313
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 11,169
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 11,157
  5. Avatar for Contenders 5. Contenders 11 pts. 11,123
  6. Avatar for AlphaFold 6. AlphaFold 5 pts. 11,086
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 10,977
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,868
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,797
  10. Avatar for Australia 10. Australia 1 pt. 10,760

  1. Avatar for blazegeek 21. blazegeek Lv 1 24 pts. 10,908
  2. Avatar for Steven Pletsch 22. Steven Pletsch Lv 1 22 pts. 10,908
  3. Avatar for BootsMcGraw 23. BootsMcGraw Lv 1 20 pts. 10,895
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 18 pts. 10,868
  5. Avatar for MicElephant 25. MicElephant Lv 1 17 pts. 10,862
  6. Avatar for guineapig 26. guineapig Lv 1 15 pts. 10,831
  7. Avatar for NPrincipi 27. NPrincipi Lv 1 14 pts. 10,817
  8. Avatar for ProfVince 28. ProfVince Lv 1 13 pts. 10,810
  9. Avatar for jausmh 29. jausmh Lv 1 12 pts. 10,763
  10. Avatar for AlkiP0Ps 30. AlkiP0Ps Lv 1 11 pts. 10,760

Comments