Icon representing a puzzle

2252: Revisiting Puzzle 63: Spinach Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 10,588
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,437
  1. Avatar for g_b 31. g_b Lv 1 10 pts. 10,757
  2. Avatar for maithra 32. maithra Lv 1 9 pts. 10,741
  3. Avatar for Skippysk8s 33. Skippysk8s Lv 1 8 pts. 10,736
  4. Avatar for crpainter 34. crpainter Lv 1 7 pts. 10,736
  5. Avatar for drjr 35. drjr Lv 1 6 pts. 10,723
  6. Avatar for bamh 36. bamh Lv 1 6 pts. 10,708
  7. Avatar for BackBuffer 37. BackBuffer Lv 1 5 pts. 10,645
  8. Avatar for lraguette 38. lraguette Lv 1 5 pts. 10,588
  9. Avatar for alcor29 39. alcor29 Lv 1 4 pts. 10,584
  10. Avatar for fpc 40. fpc Lv 1 4 pts. 10,583

Comments