Icon representing a puzzle

2252: Revisiting Puzzle 63: Spinach Protein

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Go Science 100 pts. 11,337
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,313
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 11,169
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 11,157
  5. Avatar for Contenders 5. Contenders 11 pts. 11,123
  6. Avatar for AlphaFold 6. AlphaFold 5 pts. 11,086
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 10,977
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,868
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,797
  10. Avatar for Australia 10. Australia 1 pt. 10,760

  1. Avatar for g_b 31. g_b Lv 1 10 pts. 10,757
  2. Avatar for maithra 32. maithra Lv 1 9 pts. 10,741
  3. Avatar for Skippysk8s 33. Skippysk8s Lv 1 8 pts. 10,736
  4. Avatar for crpainter 34. crpainter Lv 1 7 pts. 10,736
  5. Avatar for drjr 35. drjr Lv 1 6 pts. 10,723
  6. Avatar for bamh 36. bamh Lv 1 6 pts. 10,708
  7. Avatar for BackBuffer 37. BackBuffer Lv 1 5 pts. 10,645
  8. Avatar for lraguette 38. lraguette Lv 1 5 pts. 10,588
  9. Avatar for alcor29 39. alcor29 Lv 1 4 pts. 10,584
  10. Avatar for fpc 40. fpc Lv 1 4 pts. 10,583

Comments