Icon representing a puzzle

2256: Revisiting Puzzle 64: Thioredoxin

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 25, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,258
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,877
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,735
  4. Avatar for PFMD 14. PFMD 1 pt. 9,999
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 11,807
  2. Avatar for Galaxie 2. Galaxie Lv 1 94 pts. 11,753
  3. Avatar for LociOiling 3. LociOiling Lv 1 88 pts. 11,745
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 83 pts. 11,744
  5. Avatar for Aubade01 5. Aubade01 Lv 1 78 pts. 11,734
  6. Avatar for Timo van der Laan 6. Timo van der Laan Lv 1 73 pts. 11,696
  7. Avatar for MicElephant 7. MicElephant Lv 1 68 pts. 11,694
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 63 pts. 11,690
  9. Avatar for gmn 9. gmn Lv 1 59 pts. 11,677
  10. Avatar for drjr 10. drjr Lv 1 55 pts. 11,653

Comments