Icon representing a puzzle

2256: Revisiting Puzzle 64: Thioredoxin

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 25, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,807
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,765
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 11,696
  4. Avatar for Contenders 4. Contenders 27 pts. 11,694
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,640
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,599
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 11,556
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 11,455
  9. Avatar for Australia 9. Australia 1 pt. 11,407
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 11,297
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 11,807
  2. Avatar for Galaxie 2. Galaxie Lv 1 94 pts. 11,753
  3. Avatar for LociOiling 3. LociOiling Lv 1 88 pts. 11,745
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 83 pts. 11,744
  5. Avatar for Aubade01 5. Aubade01 Lv 1 78 pts. 11,734
  6. Avatar for Timo van der Laan 6. Timo van der Laan Lv 1 73 pts. 11,696
  7. Avatar for MicElephant 7. MicElephant Lv 1 68 pts. 11,694
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 63 pts. 11,690
  9. Avatar for gmn 9. gmn Lv 1 59 pts. 11,677
  10. Avatar for drjr 10. drjr Lv 1 55 pts. 11,653

Comments