Placeholder image of a protein
Icon representing a puzzle

2261: Electron Density Reconstruction 26

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 02, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has a couple copies of two proteins as well as peptides bound, so it will be a bit different than usual.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups


  1. Avatar for OmHS 11. OmHS 1 pt. 29,339
  2. Avatar for VeFold 12. VeFold 1 pt. 28,759

  1. Avatar for equilibria 31. equilibria Lv 1 7 pts. 29,577
  2. Avatar for WBarme1234 32. WBarme1234 Lv 1 6 pts. 29,574
  3. Avatar for RichGuilmain 33. RichGuilmain Lv 1 6 pts. 29,529
  4. Avatar for Wiz kid 34. Wiz kid Lv 1 5 pts. 29,509
  5. Avatar for NeLikomSheet 35. NeLikomSheet Lv 1 5 pts. 29,505
  6. Avatar for ucad 36. ucad Lv 1 4 pts. 29,505
  7. Avatar for HuubR 37. HuubR Lv 1 4 pts. 29,487
  8. Avatar for Idiotboy 38. Idiotboy Lv 1 3 pts. 29,471
  9. Avatar for zbp 39. zbp Lv 1 3 pts. 29,469
  10. Avatar for ShadowTactics 40. ShadowTactics Lv 1 3 pts. 29,430

Comments


MicElephant Lv 1

Why don't you fix the crashes caused by the trim button before posting such puzzles? Problem report existing since months.